PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009758869.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 380aa    MW: 42205.6 Da    PI: 6.7678
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009758869.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1252.4e-39109169262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++k ++cprC+s++tkfCyynny+++qPryfCk+C+ryWt+GG++rnvPvG+grrknk+ss
  XP_009758869.1 109 PDKLVPCPRCNSMETKFCYYNNYNVNQPRYFCKNCQRYWTAGGTMRNVPVGSGRRKNKSSS 169
                     78999*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3098166IPR003851Zinc finger, Dof-type
PfamPF027014.2E-32111167IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.463113167IPR003851Zinc finger, Dof-type
PROSITE patternPS013610115151IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MSEVRDPEIK LFGQTIGLTQ ERGLWNRKSS SYSTSTASNE DKITSKGEFT QSKQDNELVD  60
PTADSLVEPE TSSGISDELK INDADKETLS PKSAEEEDSS DQEKTLKKPD KLVPCPRCNS  120
METKFCYYNN YNVNQPRYFC KNCQRYWTAG GTMRNVPVGS GRRKNKSSST SNYGMHLPAL  180
RANGTVLTFG SDEPLCDSMA GNDQSNGVCS TSSVLTEKEN NSSTHDLKIF QAFHPQVPYF  240
QGAPWPYSGF PGSFYPAQPY WGCTLASPWN VPWLSSDQSV HNTGPSSPTL GKHSRENEGE  300
RCVLIPKTLR IDDPNEAAKS SIWSTLGIKN EKIDSVRGAR LFKAFNTKAD HRNRESDASF  360
ILQANPAALS RSLNFRESTQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC2848501e-127KC284850.1 Solanum tuberosum clone CE3130 chromosome 5 cycling DOF factor-like protein (CDF1.2) mRNA, CDF1.2-f allele, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009758869.10.0PREDICTED: cyclic dof factor 1-like
RefseqXP_016516181.10.0PREDICTED: cyclic dof factor 1-like
SwissprotQ93ZL52e-82CDF2_ARATH; Cyclic dof factor 2
TrEMBLM1BKM30.0M1BKM3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000473700.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-83cycling DOF factor 2